PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C013043P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 203aa    MW: 21848.2 Da    PI: 8.5788
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C013043P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.61.7e-401675261
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                    ++++lkcprCdstntkfCyynny+lsqPr+fCk+CrryWtkGGalrn+PvGgg+rkn k+
  MELO3C013043P1 16 EQEQLKCPRCDSTNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGALRNIPVGGGTRKNSKR 75
                    57899***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-301175IPR003851Zinc finger, Dof-type
PfamPF027011.4E-331874IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5712074IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102258IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MQDPSTFQPI KPQFPEQEQL KCPRCDSTNT KFCYYNNYNL SQPRHFCKNC RRYWTKGGAL  60
RNIPVGGGTR KNSKRAVAAT VKRPPSSSSS THPNPIAVPD HNPIRGYGGG LDIPGSFSSL  120
LASNGQFGNL LEGVDPNQSE VKMVELGEFS GSGRKSAAEE QSATVPENYL GVLQNGDSNC  180
WSGGGSNGWP DLAIFTPGSS YQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818270.0LN681827.1 Cucumis melo genomic scaffold, anchoredscaffold00018.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008447593.11e-149PREDICTED: dof zinc finger protein DOF1.7-like
SwissprotO821551e-46DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLA0A0A0LDG21e-146A0A0A0LDG2_CUCSA; Uncharacterized protein
STRINGVIT_09s0002g02490.t011e-77(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61813351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-46DOF zinc finger protein 1